SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5uzgb_ (5uzg B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2174486Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2175050Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 2175051Protein automated matches [190896] (11 species)
    not a true protein
  7. 2175073Species Human (Homo sapiens) [TaxId:9606] [188315] (83 PDB entries)
  8. 2288985Domain d5uzgb_: 5uzg B: [332286]
    automated match to d2kg0a_
    complexed with gol, so4

Details for d5uzgb_

PDB Entry: 5uzg (more details), 1.54 Å

PDB Description: crystal structure of glorund qrrm1 domain
PDB Compounds: (B:) AT27789p

SCOPe Domain Sequences for d5uzgb_:

Sequence, based on SEQRES records: (download)

>d5uzgb_ d.58.7.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pkfvrlrglpwsathkeildflenvnvtngsagihlvtsrvdgkntgeayvevasqedve
earklnkasmghryievftatpkeakeam

Sequence, based on observed residues (ATOM records): (download)

>d5uzgb_ d.58.7.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pkfvrlrglpwsathkeildflenvnvtngsagihlvtsntgeayvevasqedveearkl
nkasmghryievftatpkeakeam

SCOPe Domain Coordinates for d5uzgb_:

Click to download the PDB-style file with coordinates for d5uzgb_.
(The format of our PDB-style files is described here.)

Timeline for d5uzgb_:

  • d5uzgb_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23