SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ugba_ (5ugb A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2195690Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 protein domains)
    members organized in the groups and subfamiles specified by the comments
  6. 2196778Protein EGF receptor tyrosine kinase, Erbb-1 [82795] (1 species)
    PTK group; EGFR subfamily; membrane spanning protein tyrosine kinase
  7. 2196779Species Human (Homo sapiens) [TaxId:9606] [82796] (84 PDB entries)
    Uniprot P00533 702-1018
  8. 2288983Domain d5ugba_: 5ugb A: [332284]
    automated match to d3ikaa_
    complexed with 8bm

Details for d5ugba_

PDB Entry: 5ugb (more details), 2.53 Å

PDB Description: crystal structure of the egfr kinase domain in complex with 4-(4-{[2- {[(3s)-1-acetylpyrrolidin-3-yl]amino}-9-(propan-2-yl)-9h-purin-6- yl]amino}phenyl)-1-methylpiperazin-1-ium
PDB Compounds: (A:) Epidermal growth factor receptor

SCOPe Domain Sequences for d5ugba_:

Sequence, based on SEQRES records: (download)

>d5ugba_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]}
sgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspk
ankeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyl
lnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaegg
kvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlp
qppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsptd
snfyralmdeedmddvvdadeyli

Sequence, based on observed residues (ATOM records): (download)

>d5ugba_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]}
sgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelatspkan
keildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqylln
wcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggkv
pikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqp
pictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpdmddvv
dadeyli

SCOPe Domain Coordinates for d5ugba_:

Click to download the PDB-style file with coordinates for d5ugba_.
(The format of our PDB-style files is described here.)

Timeline for d5ugba_:

  • d5ugba_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23