Lineage for d5ugba_ (5ugb A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2195690Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 protein domains)
    members organized in the groups and subfamiles specified by the comments
  6. 2196778Protein EGF receptor tyrosine kinase, Erbb-1 [82795] (1 species)
    PTK group; EGFR subfamily; membrane spanning protein tyrosine kinase
  7. 2196779Species Human (Homo sapiens) [TaxId:9606] [82796] (88 PDB entries)
    Uniprot P00533 702-1018
  8. 2288983Domain d5ugba_: 5ugb A: [332284]
    automated match to d3ikaa_
    complexed with 8bm

Details for d5ugba_

PDB Entry: 5ugb (more details), 2.53 Å

PDB Description: crystal structure of the egfr kinase domain in complex with 4-(4-{[2- {[(3s)-1-acetylpyrrolidin-3-yl]amino}-9-(propan-2-yl)-9h-purin-6- yl]amino}phenyl)-1-methylpiperazin-1-ium
PDB Compounds: (A:) Epidermal growth factor receptor

SCOPe Domain Sequences for d5ugba_:

Sequence, based on SEQRES records: (download)

>d5ugba_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]}
sgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspk
ankeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyl
lnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaegg
kvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlp
qppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsptd
snfyralmdeedmddvvdadeyli

Sequence, based on observed residues (ATOM records): (download)

>d5ugba_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]}
sgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelatspkan
keildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqylln
wcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggkv
pikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqp
pictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpdmddvv
dadeyli

SCOPe Domain Coordinates for d5ugba_:

Click to download the PDB-style file with coordinates for d5ugba_.
(The format of our PDB-style files is described here.)

Timeline for d5ugba_:

  • d5ugba_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23