SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5uwub_ (5uwu B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2061576Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2061577Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2062158Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 2062159Protein automated matches [190052] (6 species)
    not a true protein
  7. 2062160Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [194506] (31 PDB entries)
  8. 2288975Domain d5uwub_: 5uwu B: [332276]
    Other proteins in same PDB: d5uwua_
    automated match to d4wvfb_
    complexed with cl, gnp, gol, mg

Details for d5uwub_

PDB Entry: 5uwu (more details), 2.24 Å

PDB Description: crystal structure of smad4 nes peptide in complex with crm1-ran-ranbp1
PDB Compounds: (B:) Ran-specific GTPase-activating protein 1

SCOPe Domain Sequences for d5uwub_:

Sequence, based on SEQRES records: (download)

>d5uwub_ b.55.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ihfepvvhlekvdvktmeedeevlykvraklfrfdadakewkergtgdckflknkktnkv
rilmrrdktlkicanhiiapeytlkpnvgsdrswvyactadiaegeaeaftfairfgske
nadkfkeefekaqeinkk

Sequence, based on observed residues (ATOM records): (download)

>d5uwub_ b.55.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ihfepvvtmeedeevlykvraklfrfdadakewkergtgdckflknkktnkvrilmrrdk
tlkicanhiiapeytlkpnvgsdrswvyactadiaegeaeaftfairfgskenadkfkee
fekaqeinkk

SCOPe Domain Coordinates for d5uwub_:

Click to download the PDB-style file with coordinates for d5uwub_.
(The format of our PDB-style files is described here.)

Timeline for d5uwub_:

  • d5uwub_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23