SCOPe 2.08: Domain d5x4la2: 5x4l A:107-191

Lineage for d5x4la2 (5x4l A:107-191)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.31: Cdc48 domain 2-like [54584] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.31.1: Cdc48 domain 2-like [54585] (2 families)

5. Family d.31.1.1: Cdc48 domain 2-like [54586] (4 proteins)

6. Protein Membrane fusion atpase p97 domain 2, P97-Nc [64254] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [233318] (13 PDB entries)

8. Domain d5x4la2: 5x4l A:107-191 [332271]
   Other proteins in same PDB: d5x4la1, d5x4la3, d5x4lb1, d5x4lc_, d5x4ld_
   automated match to d5dyga2

Details for d5x4la2

PDB Entry: 5x4l, 2.4 Å

PDB Description: crystal structure of the ubx domain of human ubxd7 in complex with p97 n domain

PDB Compounds: (A:) Transitional endoplasmic reticulum ATPase

SCOPe Domain Sequences for d5x4la2:

Sequence; same for both SEQRES and ATOM records:

>d5x4la2 d.31.1.1 (A:107-191) Membrane fusion atpase p97 domain 2, P97-Nc {Human (Homo sapiens) [TaxId: 9606]}
dvkygkrihvlpiddtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvv
etdpspycivapdtvihcegepikr

Timeline for d5x4la2:

• d5x4la2 first appeared in SCOPe 2.06
  
• d5x4la2 appears in SCOPe 2.07