Lineage for d5x4la2 (5x4l A:107-191)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2166602Fold d.31: Cdc48 domain 2-like [54584] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2166603Superfamily d.31.1: Cdc48 domain 2-like [54585] (2 families) (S)
  5. 2166604Family d.31.1.1: Cdc48 domain 2-like [54586] (4 protein domains)
  6. 2166619Protein Membrane fusion atpase p97 domain 2, P97-Nc [64254] (2 species)
  7. 2166620Species Human (Homo sapiens) [TaxId:9606] [233318] (11 PDB entries)
  8. 2288970Domain d5x4la2: 5x4l A:107-191 [332271]
    Other proteins in same PDB: d5x4la1, d5x4la3, d5x4lb1, d5x4lc_, d5x4ld_
    automated match to d5dyga2

Details for d5x4la2

PDB Entry: 5x4l (more details), 2.4 Å

PDB Description: crystal structure of the ubx domain of human ubxd7 in complex with p97 n domain
PDB Compounds: (A:) Transitional endoplasmic reticulum ATPase

SCOPe Domain Sequences for d5x4la2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x4la2 d.31.1.1 (A:107-191) Membrane fusion atpase p97 domain 2, P97-Nc {Human (Homo sapiens) [TaxId: 9606]}
dvkygkrihvlpiddtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvv
etdpspycivapdtvihcegepikr

SCOPe Domain Coordinates for d5x4la2:

Click to download the PDB-style file with coordinates for d5x4la2.
(The format of our PDB-style files is described here.)

Timeline for d5x4la2:

  • d5x4la2 appears in periodic updates to SCOPe 2.06 starting on 2017-03-23