SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5v10a_ (5v10 A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2167645Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2167646Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2168382Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2168383Protein automated matches [190143] (36 species)
    not a true protein
  7. 2168507Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [272670] (6 PDB entries)
  8. 2288968Domain d5v10a_: 5v10 A: [332269]
    automated match to d4i45a_
    complexed with cl

Details for d5v10a_

PDB Entry: 5v10 (more details), 1.9 Å

PDB Description: crystal structure of the putative tol-pal system-associated acyl-coa thioesterase from pseudomonas aeruginosa pao1
PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d5v10a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v10a_ d.38.1.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
raqhggkpfqqrfrvyyedtdaggivyyvnylkfmerarterlralgfaqsqlvgdnllf
vvhsaearyhapaklddellvsaeveelnraslkfrqqvrrasdsvllcegrflvacvra
dtlkpraipetlraafagspd

SCOPe Domain Coordinates for d5v10a_:

Click to download the PDB-style file with coordinates for d5v10a_.
(The format of our PDB-style files is described here.)

Timeline for d5v10a_:

  • d5v10a_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23