SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tdth_ (5tdt H:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2194444Fold d.137: Monooxygenase (hydroxylase) regulatory protein [56028] (1 superfamily)
    corner-like structure formed by two sheets and filled in with 2-3 helices
  4. 2194445Superfamily d.137.1: Monooxygenase (hydroxylase) regulatory protein [56029] (1 family) (S)
    duplication: consists of two beta-alpha-(beta)-beta(2) motifs; some topological similarity to the ferredoxin-like fold
  5. 2194446Family d.137.1.1: Monooxygenase (hydroxylase) regulatory protein [56030] (4 protein domains)
    note: the solution structure determinations disagree in the relative orientations of two motifs
  6. 2194460Protein Toluene-4-monooxygenase catalytic effector protein [64394] (1 species)
  7. 2194461Species Pseudomonas mendocina [TaxId:300] [64395] (18 PDB entries)
  8. 2288966Domain d5tdth_: 5tdt H: [332267]
    Other proteins in same PDB: d5tdta_, d5tdtc_, d5tdtd_, d5tdtg_
    automated match to d3dhie_
    complexed with fe, mbn, per

Details for d5tdth_

PDB Entry: 5tdt (more details), 1.82 Å

PDB Description: oxygenated toluene intermediate in toluene 4-monooxygenase (t4mohd) after reaction in the crystal
PDB Compounds: (H:) toluene-4-monooxygenase system protein d

SCOPe Domain Sequences for d5tdth_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tdth_ d.137.1.1 (H:) Toluene-4-monooxygenase catalytic effector protein {Pseudomonas mendocina [TaxId: 300]}
tladqalhnnnvgpiiragdlvepvietaeidnpgkeitvedrrayvriaaegeliltrk
tleeqlgrpfnmqeleinlasfagqiqadedqirfyfdktm

SCOPe Domain Coordinates for d5tdth_:

Click to download the PDB-style file with coordinates for d5tdth_.
(The format of our PDB-style files is described here.)

Timeline for d5tdth_:

  • d5tdth_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23