SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5v0ib_ (5v0i B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2105374Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2105375Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 protein domains)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 2105607Protein automated matches [190581] (9 species)
    not a true protein
  7. 2288952Species Escherichia coli [TaxId:155864] [332253] (1 PDB entry)
  8. 2288960Domain d5v0ib_: 5v0i B: [332261]
    automated match to d3n9ia_
    protein/RNA complex; complexed with amp, fmt, trp

Details for d5v0ib_

PDB Entry: 5v0i (more details), 1.9 Å

PDB Description: crystal structure of tryptophanyl-trna synthetase from escherichia coli complexed with amp and tryptophan
PDB Compounds: (B:) Tryptophan--tRNA ligase

SCOPe Domain Sequences for d5v0ib_:

Sequence, based on SEQRES records: (download)

>d5v0ib_ c.26.1.1 (B:) automated matches {Escherichia coli [TaxId: 155864]}
tkpivfsgaqpsgeltignymgalrqwvnmqddyhciycivdqhaitvrqdaqklrkatl
dtlalylacgidpekstifvqshvpehaqlgwalncytyfgelsrmtqfkdksaryaeni
naglfdypvlmaadillyqtnlvpvgedqkqhlelsrdiaqrfnalygdifkvpepfipk
sgarvmslleptkkmsksddnrnnviglledpksvvkkikravtdsdeppvvrydvqnka
gvsnlldilsavtgqsipelekqfegkmyghlkgevadavsgmltelqeryhrfrndeaf
lqqvmkdgaekasahasrtlkavyeaigfvakp

Sequence, based on observed residues (ATOM records): (download)

>d5v0ib_ c.26.1.1 (B:) automated matches {Escherichia coli [TaxId: 155864]}
tkpivfsgaqpsgeltignymgalrqwvnmqddyhciycivdqhaitvrqdaqklrkatl
dtlalylacgidpekstifvqshvpehaqlgwalncytyfgelsrmtqfkaryaeninag
lfdypvlmaadillyqtnlvpvgedqkqhlelsrdiaqrfnalygdifkvpepfarvmsl
leptkkmsksddnrnnviglledpksvvkkikravtdsdeppvvrydvqnkagvsnlldi
lsavtgqsipelekqfegkmyghlkgevadavsgmltelqeryhrfrndeaflqqvmkdg
aekasahasrtlkavyeaigfvakp

SCOPe Domain Coordinates for d5v0ib_:

Click to download the PDB-style file with coordinates for d5v0ib_.
(The format of our PDB-style files is described here.)

Timeline for d5v0ib_:

  • d5v0ib_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23