Lineage for d5v0ia_ (5v0i A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2105374Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2105375Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 protein domains)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 2105607Protein automated matches [190581] (9 species)
    not a true protein
  7. 2288952Species Escherichia coli [TaxId:155864] [332253] (1 PDB entry)
  8. 2288953Domain d5v0ia_: 5v0i A: [332254]
    automated match to d3n9ia_
    protein/RNA complex; complexed with amp, fmt, trp

Details for d5v0ia_

PDB Entry: 5v0i (more details), 1.9 Å

PDB Description: crystal structure of tryptophanyl-trna synthetase from escherichia coli complexed with amp and tryptophan
PDB Compounds: (A:) Tryptophan--tRNA ligase

SCOPe Domain Sequences for d5v0ia_:

Sequence, based on SEQRES records: (download)

>d5v0ia_ c.26.1.1 (A:) automated matches {Escherichia coli [TaxId: 155864]}
kpivfsgaqpsgeltignymgalrqwvnmqddyhciycivdqhaitvrqdaqklrkatld
tlalylacgidpekstifvqshvpehaqlgwalncytyfgelsrmtqfkdksaryaenin
aglfdypvlmaadillyqtnlvpvgedqkqhlelsrdiaqrfnalygdifkvpepfipks
garvmslleptkkmsksddnrnnviglledpksvvkkikravtdsdeppvvrydvqnkag
vsnlldilsavtgqsipelekqfegkmyghlkgevadavsgmltelqeryhrfrndeafl
qqvmkdgaekasahasrtlkavyeaigfvakp

Sequence, based on observed residues (ATOM records): (download)

>d5v0ia_ c.26.1.1 (A:) automated matches {Escherichia coli [TaxId: 155864]}
kpivfsgaqpsltignymgalrqwvnmqddyhciycivdqhaitvrqdaqklrkatldtl
alylacgidpekstifvqshvpehaqlgwalncytyfgelsrmtaeninaglfdypvlma
adillyqtnlvpvgedqkqhlelsrdiaqrfnalygdifkvpepfipksgarvmsllept
kkmsksddnrnnviglledpksvvkkikravtdsdeppvvrydvqnkagvsnlldilsav
tgqsipelekqfegkmyghlkgevadavsgmltelqeryhrfrndeaflqqvmkdgaeka
sahasrtlkavyeaigfvakp

SCOPe Domain Coordinates for d5v0ia_:

Click to download the PDB-style file with coordinates for d5v0ia_.
(The format of our PDB-style files is described here.)

Timeline for d5v0ia_:

  • d5v0ia_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23