SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5v38a1 (5v38 A:863-1071)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2044115Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2044116Protein automated matches [190437] (52 species)
    not a true protein
  7. 2044196Species Clostridium botulinum [TaxId:1491] [225675] (22 PDB entries)
  8. 2288948Domain d5v38a1: 5v38 A:863-1071 [332249]
    Other proteins in same PDB: d5v38a2, d5v38b2
    automated match to d2vuaa1
    complexed with acy

Details for d5v38a1

PDB Entry: 5v38 (more details), 1.8 Å

PDB Description: crystal structure of the receptor-binding domain of botulinum neurotoxin type ha
PDB Compounds: (A:) HcHA

SCOPe Domain Sequences for d5v38a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v38a1 b.29.1.0 (A:863-1071) automated matches {Clostridium botulinum [TaxId: 1491]}
yncilnikyemdrdklvdssgyrsrinigtgvkfseidknqvqlsnlesskievilnngv
iynsmyenfstsfwiripkyfrninneykiiscmqnnsgwevslnfsnmnskiiwtlqdt
egikktvvfqytqninisdyinrwifvtitnnrlsnskiyingrlineesisdlgnihas
nnimfkldgcrdphryiwikyfnlfdkel

SCOPe Domain Coordinates for d5v38a1:

Click to download the PDB-style file with coordinates for d5v38a1.
(The format of our PDB-style files is described here.)

Timeline for d5v38a1:

  • d5v38a1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-23

View in 3D
Domains from same chain:
(mouse over for more information)
d5v38a2