Lineage for d5uv2a1 (5uv2 A:61-263)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2007005Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2007408Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 2007735Family a.102.4.0: automated matches [227201] (1 protein)
    not a true family
  6. 2007736Protein automated matches [226931] (9 species)
    not a true protein
  7. 2007740Species Citrus sinensis [TaxId:2711] [332182] (3 PDB entries)
  8. 2007741Domain d5uv2a1: 5uv2 A:61-263 [332239]
    Other proteins in same PDB: d5uv2a2
    automated match to d3n0fa1
    complexed with la6, mn

Details for d5uv2a1

PDB Entry: 5uv2 (more details), 2.2 Å

PDB Description: crystal structure of (+)-limonene synthase complexed with 2- fluoroneryl diphosphate
PDB Compounds: (A:) (+)-limonene synthase

SCOPe Domain Sequences for d5uv2a1:

Sequence, based on SEQRES records: (download)

>d5uv2a1 a.102.4.0 (A:61-263) automated matches {Citrus sinensis [TaxId: 2711]}
siwdhdflqslnsnytdetykrraeelkgkvktaikdvtepldqlelidnlqrlglayhf
epeirnilrnihnhnkdynwrkenlyatslefrllrqhgypvsqevfsgfkddkvgficd
dfkgilslheasyyslegesimeeawqftskhlkemmitsnskeedvfvaeqakralelp
lhwkapmlearwfihvyekredk

Sequence, based on observed residues (ATOM records): (download)

>d5uv2a1 a.102.4.0 (A:61-263) automated matches {Citrus sinensis [TaxId: 2711]}
siwdhdflqslnsnytdetykrraeelkgkvktaikdvtepldqlelidnlqrlglayhf
epeirnilrnihnhnkdynwrkenlyatslefrllrqhgypvsqevfsgfkddkvgficd
dfkgilslheasyyslegesimeeawqftskhlkemmidvfvaeqakralelplhwkapm
learwfihvyekredk

SCOPe Domain Coordinates for d5uv2a1:

Click to download the PDB-style file with coordinates for d5uv2a1.
(The format of our PDB-style files is described here.)

Timeline for d5uv2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5uv2a2