Class a: All alpha proteins [46456] (289 folds) |
Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) |
Family a.102.4.0: automated matches [227201] (1 protein) not a true family |
Protein automated matches [226931] (9 species) not a true protein |
Species Citrus sinensis [TaxId:2711] [332182] (3 PDB entries) |
Domain d5uv2a1: 5uv2 A:61-263 [332239] Other proteins in same PDB: d5uv2a2 automated match to d3n0fa1 complexed with la6, mn |
PDB Entry: 5uv2 (more details), 2.2 Å
SCOPe Domain Sequences for d5uv2a1:
Sequence, based on SEQRES records: (download)
>d5uv2a1 a.102.4.0 (A:61-263) automated matches {Citrus sinensis [TaxId: 2711]} siwdhdflqslnsnytdetykrraeelkgkvktaikdvtepldqlelidnlqrlglayhf epeirnilrnihnhnkdynwrkenlyatslefrllrqhgypvsqevfsgfkddkvgficd dfkgilslheasyyslegesimeeawqftskhlkemmitsnskeedvfvaeqakralelp lhwkapmlearwfihvyekredk
>d5uv2a1 a.102.4.0 (A:61-263) automated matches {Citrus sinensis [TaxId: 2711]} siwdhdflqslnsnytdetykrraeelkgkvktaikdvtepldqlelidnlqrlglayhf epeirnilrnihnhnkdynwrkenlyatslefrllrqhgypvsqevfsgfkddkvgficd dfkgilslheasyyslegesimeeawqftskhlkemmidvfvaeqakralelplhwkapm learwfihvyekredk
Timeline for d5uv2a1: