SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5uv2a1 (5uv2 A:61-263)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004426Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 2004750Family a.102.4.0: automated matches [227201] (1 protein)
    not a true family
  6. 2004751Protein automated matches [226931] (8 species)
    not a true protein
  7. 2288881Species Citrus sinensis [TaxId:2711] [332182] (3 PDB entries)
  8. 2288938Domain d5uv2a1: 5uv2 A:61-263 [332239]
    Other proteins in same PDB: d5uv2a2
    automated match to d3n0fa1
    complexed with la6, mn

Details for d5uv2a1

PDB Entry: 5uv2 (more details), 2.2 Å

PDB Description: crystal structure of (+)-limonene synthase complexed with 2- fluoroneryl diphosphate
PDB Compounds: (A:) (+)-limonene synthase

SCOPe Domain Sequences for d5uv2a1:

Sequence, based on SEQRES records: (download)

>d5uv2a1 a.102.4.0 (A:61-263) automated matches {Citrus sinensis [TaxId: 2711]}
siwdhdflqslnsnytdetykrraeelkgkvktaikdvtepldqlelidnlqrlglayhf
epeirnilrnihnhnkdynwrkenlyatslefrllrqhgypvsqevfsgfkddkvgficd
dfkgilslheasyyslegesimeeawqftskhlkemmitsnskeedvfvaeqakralelp
lhwkapmlearwfihvyekredk

Sequence, based on observed residues (ATOM records): (download)

>d5uv2a1 a.102.4.0 (A:61-263) automated matches {Citrus sinensis [TaxId: 2711]}
siwdhdflqslnsnytdetykrraeelkgkvktaikdvtepldqlelidnlqrlglayhf
epeirnilrnihnhnkdynwrkenlyatslefrllrqhgypvsqevfsgfkddkvgficd
dfkgilslheasyyslegesimeeawqftskhlkemmidvfvaeqakralelplhwkapm
learwfihvyekredk

SCOPe Domain Coordinates for d5uv2a1:

Click to download the PDB-style file with coordinates for d5uv2a1.
(The format of our PDB-style files is described here.)

Timeline for d5uv2a1:

  • d5uv2a1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-23

View in 3D
Domains from same chain:
(mouse over for more information)
d5uv2a2