Lineage for d5uzec_ (5uze C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080656Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (2 families) (S)
    The phosphate moiety of substrate binds in the 'common' phosphate-binding site
  5. 2080703Family c.1.5.0: automated matches [227276] (1 protein)
    not a true family
  6. 2080704Protein automated matches [227084] (14 species)
    not a true protein
  7. 2080757Species Clostridium perfringens [TaxId:195103] [258287] (9 PDB entries)
  8. 2288933Domain d5uzec_: 5uze C: [332234]
    automated match to d4q33a_
    complexed with 8l1, gol, imp, k

Details for d5uzec_

PDB Entry: 5uze (more details), 2.27 Å

PDB Description: crystal structure of inosine 5'-monophosphate dehydrogenase from clostridium perfringens complexed with imp and p182
PDB Compounds: (C:) Inosine-5'-monophosphate dehydrogenase,Inosine-5'-monophosphate dehydrogenase

SCOPe Domain Sequences for d5uzec_:

Sequence, based on SEQRES records: (download)

>d5uzec_ c.1.5.0 (C:) automated matches {Clostridium perfringens [TaxId: 195103]}
arilktaytfddvllvpnksevlpnevslktqltkkiqlniplmsasmdtvteskmaiam
areggigiihknmtiedqarevdrvkrsggllcgasigvtndmmervdavvkakvdvivl
dtahghskgviegvkrikakypelqviagniatpeavrdlaeagadcvkvgigpgsictt
rivagvgvpqltavmdcaeegkklgipviadgglkysgdivkalaagacaammgsifagc
eeapgaieiyqgrsykvyrgmgslgamakgssdryfqngtkkfvpegvegriaykghlad
tiyqliggiksgmgylgaptlenlyenanfvvqtsagfreshphdinitkeapnys

Sequence, based on observed residues (ATOM records): (download)

>d5uzec_ c.1.5.0 (C:) automated matches {Clostridium perfringens [TaxId: 195103]}
arilktaytfddvllvpnksevlpnevslktqltkkiqlniplmsasmdtvteskmaiam
areggigiihknmtiedqarevdrvkrsggllcgasigvtndmmervdavvkakvdvivl
dtahghskgviegvkrikakypelqviagniatpeavrdlaeagadcvkvgigpgsictt
rivagvgvpqltavmdcaeegkklgipviadgglkysgdivkalaagacaammgsifagc
eeapgaieiyqgrsykvyrgmgslgamavpegvegriaykghladtiyqliggiksgmgy
lgaptlenlyenanfvvqtsagfreshphdinitkeapnys

SCOPe Domain Coordinates for d5uzec_:

Click to download the PDB-style file with coordinates for d5uzec_.
(The format of our PDB-style files is described here.)

Timeline for d5uzec_:

  • d5uzec_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23