SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5x4lb2 (5x4l B:107-191)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2166602Fold d.31: Cdc48 domain 2-like [54584] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2166603Superfamily d.31.1: Cdc48 domain 2-like [54585] (2 families) (S)
  5. 2166604Family d.31.1.1: Cdc48 domain 2-like [54586] (4 protein domains)
  6. 2166619Protein Membrane fusion atpase p97 domain 2, P97-Nc [64254] (2 species)
  7. 2166620Species Human (Homo sapiens) [TaxId:9606] [233318] (11 PDB entries)
  8. 2288932Domain d5x4lb2: 5x4l B:107-191 [332233]
    Other proteins in same PDB: d5x4la1, d5x4la3, d5x4lb1, d5x4lc_, d5x4ld_
    automated match to d5dyga2

Details for d5x4lb2

PDB Entry: 5x4l (more details), 2.4 Å

PDB Description: crystal structure of the ubx domain of human ubxd7 in complex with p97 n domain
PDB Compounds: (B:) Transitional endoplasmic reticulum ATPase

SCOPe Domain Sequences for d5x4lb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x4lb2 d.31.1.1 (B:107-191) Membrane fusion atpase p97 domain 2, P97-Nc {Human (Homo sapiens) [TaxId: 9606]}
dvkygkrihvlpiddtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvv
etdpspycivapdtvihcegepikr

SCOPe Domain Coordinates for d5x4lb2:

Click to download the PDB-style file with coordinates for d5x4lb2.
(The format of our PDB-style files is described here.)

Timeline for d5x4lb2:

  • d5x4lb2 appears in periodic updates to SCOPe 2.06 starting on 2017-03-23