SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5x4lb1 (5x4l B:24-106)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2061141Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 2061195Superfamily b.52.2: ADC-like [50692] (4 families) (S)
  5. 2061340Family b.52.2.3: Cdc48 N-terminal domain-like [50708] (4 protein domains)
  6. 2061341Protein Membrane fusion ATPase p97 N-terminal domain , P97-Nn [63796] (2 species)
  7. 2061342Species Human (Homo sapiens) [TaxId:9606] [233316] (11 PDB entries)
  8. 2288931Domain d5x4lb1: 5x4l B:24-106 [332232]
    Other proteins in same PDB: d5x4la2, d5x4la3, d5x4lb2, d5x4lc_, d5x4ld_
    automated match to d5dyga1

Details for d5x4lb1

PDB Entry: 5x4l (more details), 2.4 Å

PDB Description: crystal structure of the ubx domain of human ubxd7 in complex with p97 n domain
PDB Compounds: (B:) Transitional endoplasmic reticulum ATPase

SCOPe Domain Sequences for d5x4lb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x4lb1 b.52.2.3 (B:24-106) Membrane fusion ATPase p97 N-terminal domain , P97-Nn {Human (Homo sapiens) [TaxId: 9606]}
nrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddtcsdekir
mnrvvrnnlrvrlgdvisiqpcp

SCOPe Domain Coordinates for d5x4lb1:

Click to download the PDB-style file with coordinates for d5x4lb1.
(The format of our PDB-style files is described here.)

Timeline for d5x4lb1:

  • d5x4lb1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-23