Lineage for d5uzma_ (5uzm A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2174486Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2175050Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 2175051Protein automated matches [190896] (11 species)
    not a true protein
  7. 2175073Species Human (Homo sapiens) [TaxId:9606] [188315] (87 PDB entries)
  8. 2288930Domain d5uzma_: 5uzm A: [332231]
    automated match to d2kfya_

Details for d5uzma_

PDB Entry: 5uzm (more details), 1.55 Å

PDB Description: crystal structure of glorund qrrm2 domain
PDB Compounds: (A:) AT27789p

SCOPe Domain Sequences for d5uzma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uzma_ d.58.7.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gtafvvklrglpyavteqqieeffsgldiktdregilfvmdrrgratgeafvqfesqddt
eqalgrnrekighryieifrssiaemkrat

SCOPe Domain Coordinates for d5uzma_:

Click to download the PDB-style file with coordinates for d5uzma_.
(The format of our PDB-style files is described here.)

Timeline for d5uzma_:

  • d5uzma_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23

View in 3D
Domains from other chains:
(mouse over for more information)
d5uzmb_