SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5uzma_ (5uzm A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2174486Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2175050Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 2175051Protein automated matches [190896] (11 species)
    not a true protein
  7. 2175073Species Human (Homo sapiens) [TaxId:9606] [188315] (83 PDB entries)
  8. 2288930Domain d5uzma_: 5uzm A: [332231]
    automated match to d2kfya_

Details for d5uzma_

PDB Entry: 5uzm (more details), 1.55 Å

PDB Description: crystal structure of glorund qrrm2 domain
PDB Compounds: (A:) AT27789p

SCOPe Domain Sequences for d5uzma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uzma_ d.58.7.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gtafvvklrglpyavteqqieeffsgldiktdregilfvmdrrgratgeafvqfesqddt
eqalgrnrekighryieifrssiaemkrat

SCOPe Domain Coordinates for d5uzma_:

Click to download the PDB-style file with coordinates for d5uzma_.
(The format of our PDB-style files is described here.)

Timeline for d5uzma_:

  • d5uzma_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23

View in 3D
Domains from other chains:
(mouse over for more information)
d5uzmb_