Lineage for d5uwta_ (5uwt A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2110099Family c.37.1.8: G proteins [52592] (79 protein domains)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2110833Protein Ran [52609] (2 species)
  7. 2110834Species Dog (Canis familiaris) [TaxId:9615] [52610] (20 PDB entries)
    Uniprot P62825
  8. 2288928Domain d5uwta_: 5uwt A: [332229]
    Other proteins in same PDB: d5uwtb_
    automated match to d1qg4b_
    complexed with gnp, gol, mg; mutant

Details for d5uwta_

PDB Entry: 5uwt (more details), 2.34 Å

PDB Description: crystal structure of hxk2 peptide in complex with crm1 k579a mutant- ran-ranbp1
PDB Compounds: (A:) GTP-binding nuclear protein ran

SCOPe Domain Sequences for d5uwta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uwta_ c.37.1.8 (A:) Ran {Dog (Canis familiaris) [TaxId: 9615]}
vqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdtag
qekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdikd
rkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappevv
mdpalaaqyehdlevaqttalpdedddl

SCOPe Domain Coordinates for d5uwta_:

Click to download the PDB-style file with coordinates for d5uwta_.
(The format of our PDB-style files is described here.)

Timeline for d5uwta_:

  • d5uwta_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23