Lineage for d5uzga_ (5uzg A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2518968Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2519561Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 2519562Protein automated matches [190896] (11 species)
    not a true protein
  7. 2519592Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [332223] (2 PDB entries)
  8. 2519593Domain d5uzga_: 5uzg A: [332225]
    automated match to d2kg0a_
    complexed with gol, so4

Details for d5uzga_

PDB Entry: 5uzg (more details), 1.54 Å

PDB Description: crystal structure of glorund qrrm1 domain
PDB Compounds: (A:) AT27789p

SCOPe Domain Sequences for d5uzga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uzga_ d.58.7.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
pkfvrlrglpwsathkeildflenvnvtngsagihlvtsrvdgkntgeayvevasqedve
earklnkasmghryievftatpkeakeamr

SCOPe Domain Coordinates for d5uzga_:

Click to download the PDB-style file with coordinates for d5uzga_.
(The format of our PDB-style files is described here.)

Timeline for d5uzga_: