SCOPe 2.08: Domain d5uzga_: 5uzg A:

Lineage for d5uzga_ (5uzg A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families)

5. Family d.58.7.0: automated matches [191529] (1 protein)
   not a true family

6. Protein automated matches [190896] (11 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [332223] (3 PDB entries)

8. Domain d5uzga_: 5uzg A: [332225]
   automated match to d2kg0a_
   complexed with gol, so4

Details for d5uzga_

PDB Entry: 5uzg, 1.54 Å

PDB Description: crystal structure of glorund qrrm1 domain

PDB Compounds: (A:) AT27789p

SCOPe Domain Sequences for d5uzga_:

Sequence; same for both SEQRES and ATOM records:

>d5uzga_ d.58.7.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
pkfvrlrglpwsathkeildflenvnvtngsagihlvtsrvdgkntgeayvevasqedve
earklnkasmghryievftatpkeakeamr

Timeline for d5uzga_:

• d5uzga_ first appeared in SCOPe 2.06
  
• d5uzga_ appears in SCOPe 2.07