Lineage for d5tz3c_ (5tz3 C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014835Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2014836Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2015250Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 2015251Protein automated matches [190983] (9 species)
    not a true protein
  7. 2015252Species Human (Homo sapiens) [TaxId:9606] [188676] (111 PDB entries)
  8. 2288916Domain d5tz3c_: 5tz3 C: [332217]
    Other proteins in same PDB: d5tz3a2, d5tz3b2
    automated match to d4d09a_
    complexed with 7om, mg, zn

Details for d5tz3c_

PDB Entry: 5tz3 (more details), 1.72 Å

PDB Description: crystal structure of human phosphodiesterase 2a in complex with [1,2, 4]triazolo[1,5-a]pyrimidin-7-yl}-n-(naphthalene-2-yl)piperidine-3- carboxamide
PDB Compounds: (C:) cGMP-dependent 3',5'-cyclic phosphodiesterase

SCOPe Domain Sequences for d5tz3c_:

Sequence, based on SEQRES records: (download)

>d5tz3c_ a.211.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
deytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcptl
arfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchdld
hrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrmld
lmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwktt
rkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdlfp
kaaelyervasnrehwtkvshkftirglpsnnsldfl

Sequence, based on observed residues (ATOM records): (download)

>d5tz3c_ a.211.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
deytklgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcptlarf
clmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchdldhrg
tnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrmldlmr
diilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwkttrki
aeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdlfpkaa
elyervasnrehwtkvshkftirglpsnnsldfl

SCOPe Domain Coordinates for d5tz3c_:

Click to download the PDB-style file with coordinates for d5tz3c_.
(The format of our PDB-style files is described here.)

Timeline for d5tz3c_:

  • d5tz3c_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23