SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5uqwb_ (5uqw B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2110099Family c.37.1.8: G proteins [52592] (79 protein domains)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2111131Protein automated matches [190047] (28 species)
    not a true protein
  7. 2111209Species Human (Homo sapiens) [TaxId:9606] [186768] (155 PDB entries)
  8. 2288915Domain d5uqwb_: 5uqw B: [332216]
    automated match to d4obea_
    complexed with gdp, mg; mutant

Details for d5uqwb_

PDB Entry: 5uqw (more details), 1.5 Å

PDB Description: crystal structure of human kras g12v mutant in complex with gdp
PDB Compounds: (B:) GTPase KRas

SCOPe Domain Sequences for d5uqwb_:

Sequence, based on SEQRES records: (download)

>d5uqwb_ c.37.1.8 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdl
psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhk

Sequence, based on observed residues (ATOM records): (download)

>d5uqwb_ c.37.1.8 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtam
rtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdlpsrtvdtkqaqd
larsygipfietsaktrqgvddafytlvreirkhk

SCOPe Domain Coordinates for d5uqwb_:

Click to download the PDB-style file with coordinates for d5uqwb_.
(The format of our PDB-style files is described here.)

Timeline for d5uqwb_:

  • d5uqwb_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23