SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tdsa_ (5tds A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988413Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1988414Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1990025Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 protein domains)
  6. 1990319Protein automated matches [190435] (11 species)
    not a true protein
  7. 1990411Species Pseudomonas mendocina [TaxId:300] [188695] (20 PDB entries)
  8. 2288911Domain d5tdsa_: 5tds A: [332212]
    Other proteins in same PDB: d5tdsc_, d5tdsf_
    automated match to d3dhgd_
    complexed with cl, fe, mbn, mg

Details for d5tdsa_

PDB Entry: 5tds (more details), 1.72 Å

PDB Description: toluene bound in the resting active site of toluene 4-monooxygenase (t4moh)
PDB Compounds: (A:) Toluene-4-monooxygenase system protein A

SCOPe Domain Sequences for d5tdsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tdsa_ a.25.1.2 (A:) automated matches {Pseudomonas mendocina [TaxId: 300]}
amhprkdwyeltratnwtpsyvteeqlfpermsghmgiplekwesydepyktsypeyvsi
qrekdagaysvkaalerakiyensdpgwistlkshygaiavgeyaavtgegrmarfskap
gnrnmatfgmmdelrhgqlqlffpheyckkdrqfdwawrayhsnewaaiaakhffddiit
grdaisvaimltfsfetgftnmqflglaadaaeagdytfanlissiqtdesrhaqqggpa
lqlliengkreeaqkkvdmaiwrawrlfavltgpvmdyytpledrsqsfkefmyewiigq
ferslidlgldkpwywdlflkdidelhhsyhmgvwywrttawwnpaagvtpeerdwleek
ypgwnkrwgrcwdvitenvlndrmdlvspetlpsvcnmsqiplvgvpgddwnievfsleh
ngrlyhfgsevdrwvfqqdpvqyqnhmnivdrflagqiqpmtlegalkymgfqsieemgk
dahdfawadk

SCOPe Domain Coordinates for d5tdsa_:

Click to download the PDB-style file with coordinates for d5tdsa_.
(The format of our PDB-style files is described here.)

Timeline for d5tdsa_:

  • d5tdsa_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23