SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5x3pa_ (5x3p A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2158219Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2158220Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2159468Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2159469Protein automated matches [190233] (21 species)
    not a true protein
  7. 2159501Species Human (Homo sapiens) [TaxId:9606] [187090] (74 PDB entries)
  8. 2288907Domain d5x3pa_: 5x3p A: [332208]
    automated match to d3r3mb_

Details for d5x3pa_

PDB Entry: 5x3p (more details), 2 Å

PDB Description: crystal structure of the ubx domain of human ubxd7
PDB Compounds: (A:) UBX domain-containing protein 7

SCOPe Domain Sequences for d5x3pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x3pa_ d.15.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpkaqlmlrypdgkreqitlpeqakllalvkhvqskgypnerfelltnfprrklshldyd
itmqeaglcpqetvfvqern

SCOPe Domain Coordinates for d5x3pa_:

Click to download the PDB-style file with coordinates for d5x3pa_.
(The format of our PDB-style files is described here.)

Timeline for d5x3pa_:

  • d5x3pa_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23