Lineage for d5x3pb_ (5x3p B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2158219Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2158220Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2159468Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2159469Protein automated matches [190233] (22 species)
    not a true protein
  7. 2159501Species Human (Homo sapiens) [TaxId:9606] [187090] (77 PDB entries)
  8. 2288903Domain d5x3pb_: 5x3p B: [332204]
    automated match to d3r3mb_

Details for d5x3pb_

PDB Entry: 5x3p (more details), 2 Å

PDB Description: crystal structure of the ubx domain of human ubxd7
PDB Compounds: (B:) UBX domain-containing protein 7

SCOPe Domain Sequences for d5x3pb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x3pb_ d.15.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpkaqlmlrypdgkreqitlpeqakllalvkhvqskgypnerfelltnfprrklshldyd
itmqeaglcpqetvfvqer

SCOPe Domain Coordinates for d5x3pb_:

Click to download the PDB-style file with coordinates for d5x3pb_.
(The format of our PDB-style files is described here.)

Timeline for d5x3pb_:

  • d5x3pb_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23