Lineage for d5u3qa_ (5u3q A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009403Protein automated matches [190059] (14 species)
    not a true protein
  7. 2009425Species Human (Homo sapiens) [TaxId:9606] [187214] (172 PDB entries)
  8. 2288889Domain d5u3qa_: 5u3q A: [332190]
    automated match to d2p4ya_
    complexed with 7uj, b7g, cl, k, peg, pgo

Details for d5u3qa_

PDB Entry: 5u3q (more details), 1.5 Å

PDB Description: human ppardelta ligand-binding domain in complexed with specific agonist 1
PDB Compounds: (A:) Peroxisome proliferator-activated receptor delta

SCOPe Domain Sequences for d5u3qa_:

Sequence, based on SEQRES records: (download)

>d5u3qa_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adlkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwkqlv
nglppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifa
mlasivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfi
aaiilcgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlvte
haqmmqrikktetetslhpllqeiykdmy

Sequence, based on observed residues (ATOM records): (download)

>d5u3qa_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adlkafskhiynaylknfnmtkkkarsiltgtapfvihdietlwqaekglvwkqlvnglp
pykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifamlas
ivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaaii
lcgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlvtehaqm
mqrikktetetslhpllqeiykdmy

SCOPe Domain Coordinates for d5u3qa_:

Click to download the PDB-style file with coordinates for d5u3qa_.
(The format of our PDB-style files is described here.)

Timeline for d5u3qa_:

  • d5u3qa_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23