Lineage for d5uv0a2 (5uv0 A:264-592)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010547Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2010548Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2010904Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 2010905Protein automated matches [196409] (35 species)
    not a true protein
  7. 2288883Species Citrus sinensis [TaxId:2711] [332184] (3 PDB entries)
  8. 2288884Domain d5uv0a2: 5uv0 A:264-592 [332185]
    Other proteins in same PDB: d5uv0a1
    automated match to d3n0fa2

Details for d5uv0a2

PDB Entry: 5uv0 (more details), 2.3 Å

PDB Description: crystal structure of (+)-limonene synthase from citrus sinensis
PDB Compounds: (A:) (+)-limonene synthase

SCOPe Domain Sequences for d5uv0a2:

Sequence, based on SEQRES records: (download)

>d5uv0a2 a.128.1.0 (A:264-592) automated matches {Citrus sinensis [TaxId: 2711]}
nhlllelaklefntlqaiyqeelkdisgwwkdtglgeklsfarnrlvasflwsmgiafep
qfaycrrvltisialitviddiydvygtldeleiftdavarwdinyalkhlpgymkmcfl
alynfvnefayyvlkqqdfdmllsikhawlgliqaylveakwyhskytpkleeylenglv
sitgpliitisylsgtnpiikkeleflesnpdivhwsskifrlqddlgtssdeiqrgdvp
ksiqcymhetgaseevarehikdmmrqmwkkvnaytadkdspltrttaefllnlvrmshf
mylhgdghgvqnqetidvgftllfqpipl

Sequence, based on observed residues (ATOM records): (download)

>d5uv0a2 a.128.1.0 (A:264-592) automated matches {Citrus sinensis [TaxId: 2711]}
nhlllelaklefntlqaiyqeelkdisgwwkdtglgeklsfarnrlvasflwsmgiafep
qfaycrrvltisialitviddiydvygtldeleiftdavarwdinyalkhlpgymkmcfl
alynfvnefayyvlkqqdfdmllsikhawlgliqaylveakwyhskytpkleeylenglv
sitgpliitisylsgtnpiikkeleflesnpdivhwsskifrlqddlgtssdeiqrgdvp
ksiqcymhetgaseevarehikdmmrqmwkkvnaytadkdspltrttaefllnlvrmshf
mylhgdghgvtidvgftllfqpipl

SCOPe Domain Coordinates for d5uv0a2:

Click to download the PDB-style file with coordinates for d5uv0a2.
(The format of our PDB-style files is described here.)

Timeline for d5uv0a2:

  • d5uv0a2 appears in periodic updates to SCOPe 2.06 starting on 2017-03-23

View in 3D
Domains from same chain:
(mouse over for more information)
d5uv0a1