Lineage for d5tduc_ (5tdu C:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2158219Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2160960Superfamily d.15.12: TmoB-like [110814] (2 families) (S)
    possibly related to the ubiquitin-like and/or 2Fe-2S ferredoxin-like superfamilies
  5. 2160982Family d.15.12.0: automated matches [191572] (1 protein)
    not a true family
  6. 2160983Protein automated matches [190991] (1 species)
    not a true protein
  7. 2160984Species Pseudomonas mendocina [TaxId:300] [188696] (20 PDB entries)
  8. 2288879Domain d5tduc_: 5tdu C: [332180]
    Other proteins in same PDB: d5tdua_, d5tdue_
    automated match to d3q14c_
    complexed with fe, pcr

Details for d5tduc_

PDB Entry: 5tdu (more details), 1.74 Å

PDB Description: toluene 4-monooxygenase (t4mohd) bound to product after turnover in crystal
PDB Compounds: (C:) Toluene-4-monooxygenase system protein B

SCOPe Domain Sequences for d5tduc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tduc_ d.15.12.0 (C:) automated matches {Pseudomonas mendocina [TaxId: 300]}
safpvhaafekdflvqlvvvdlndsmdqvaekvayhcvnrrvapregvmrvrkhrstelf
prdmtiaesglnptevidvvfee

SCOPe Domain Coordinates for d5tduc_:

Click to download the PDB-style file with coordinates for d5tduc_.
(The format of our PDB-style files is described here.)

Timeline for d5tduc_:

  • d5tduc_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23