SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5u3fb_ (5u3f B:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2221894Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
    2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8
  4. 2221895Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) (S)
  5. 2221992Family e.17.1.0: automated matches [191499] (1 protein)
    not a true family
  6. 2221993Protein automated matches [190815] (13 species)
    not a true protein
  7. 2288834Species Mycobacterium tuberculosis [TaxId:83332] [332135] (1 PDB entry)
  8. 2288878Domain d5u3fb_: 5u3f B: [332179]
    automated match to d3jz6a_
    complexed with 7ts

Details for d5u3fb_

PDB Entry: 5u3f (more details), 1.7 Å

PDB Description: structure of mycobacterium tuberculosis ilve, a branched-chain amino acid transaminase, in complex with d-cycloserine derivative
PDB Compounds: (B:) branched-chain-amino-acid aminotransferase

SCOPe Domain Sequences for d5u3fb_:

Sequence, based on SEQRES records: (download)

>d5u3fb_ e.17.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
yhtdhmvsidyaegrgwhnarvipygpieldpsaivlhyaqevfeglkayrwadgsivsf
radanaarlrssarrlaipelpdavfieslrqliavdkawvpgaggeealylrpfifate
pglgvrpatqyrylliaspagayfkggiapvsvwvsteyvracpggtgaakfggnyaasl
laqaeaaengcdqvvwldaverryieemggmniffvlgsggsarlvtpelsgsllpgitr
dsllqlaidagfaveerrididewqkkaaageitevfacgtaavitpvarvrhgasefri
adgqpgevtmalrdtltgiqrgtfadthgwmarlg

Sequence, based on observed residues (ATOM records): (download)

>d5u3fb_ e.17.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
yhtdhmvsidyaegrgwhnarvipygpieldpsaivlhyaqevfeglkayrwadgsivsf
radanaarlrssarrlaipelpdavfieslrqliavdkawvpgaggeealylrpfifate
pglgvrpatqyrylliaspaiapvsvwvsteyvracpggtgaakfggnyaasllaqaeaa
engcdqvvwldaverryieemggmniffvlgsggsarlvtpelsgsllpgitrdsllqla
idagfaveerrididewqkkaaageitevfacgtaavitpvarvrhgasefriadgqpge
vtmalrdtltgiqrgtfadthgwmarlg

SCOPe Domain Coordinates for d5u3fb_:

Click to download the PDB-style file with coordinates for d5u3fb_.
(The format of our PDB-style files is described here.)

Timeline for d5u3fb_:

  • d5u3fb_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23