Lineage for d5u3fb_ (5u3f B:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2221894Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
    2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8
  4. 2221895Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) (S)
  5. 2221992Family e.17.1.0: automated matches [191499] (1 protein)
    not a true family
  6. 2221993Protein automated matches [190815] (13 species)
    not a true protein
  7. 2288834Species Mycobacterium tuberculosis [TaxId:83332] [332135] (1 PDB entry)
  8. 2288878Domain d5u3fb_: 5u3f B: [332179]
    automated match to d3jz6a_
    complexed with 7ts

Details for d5u3fb_

PDB Entry: 5u3f (more details), 1.7 Å

PDB Description: structure of mycobacterium tuberculosis ilve, a branched-chain amino acid transaminase, in complex with d-cycloserine derivative
PDB Compounds: (B:) branched-chain-amino-acid aminotransferase

SCOPe Domain Sequences for d5u3fb_:

Sequence, based on SEQRES records: (download)

>d5u3fb_ e.17.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
yhtdhmvsidyaegrgwhnarvipygpieldpsaivlhyaqevfeglkayrwadgsivsf
radanaarlrssarrlaipelpdavfieslrqliavdkawvpgaggeealylrpfifate
pglgvrpatqyrylliaspagayfkggiapvsvwvsteyvracpggtgaakfggnyaasl
laqaeaaengcdqvvwldaverryieemggmniffvlgsggsarlvtpelsgsllpgitr
dsllqlaidagfaveerrididewqkkaaageitevfacgtaavitpvarvrhgasefri
adgqpgevtmalrdtltgiqrgtfadthgwmarlg

Sequence, based on observed residues (ATOM records): (download)

>d5u3fb_ e.17.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
yhtdhmvsidyaegrgwhnarvipygpieldpsaivlhyaqevfeglkayrwadgsivsf
radanaarlrssarrlaipelpdavfieslrqliavdkawvpgaggeealylrpfifate
pglgvrpatqyrylliaspaiapvsvwvsteyvracpggtgaakfggnyaasllaqaeaa
engcdqvvwldaverryieemggmniffvlgsggsarlvtpelsgsllpgitrdsllqla
idagfaveerrididewqkkaaageitevfacgtaavitpvarvrhgasefriadgqpge
vtmalrdtltgiqrgtfadthgwmarlg

SCOPe Domain Coordinates for d5u3fb_:

Click to download the PDB-style file with coordinates for d5u3fb_.
(The format of our PDB-style files is described here.)

Timeline for d5u3fb_:

  • d5u3fb_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23