Lineage for d5usjb1 (5usj B:1-167)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2110099Family c.37.1.8: G proteins [52592] (79 protein domains)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2111131Protein automated matches [190047] (28 species)
    not a true protein
  7. 2111209Species Human (Homo sapiens) [TaxId:9606] [186768] (165 PDB entries)
  8. 2288871Domain d5usjb1: 5usj B:1-167 [332172]
    Other proteins in same PDB: d5usja2, d5usjb2, d5usjc2, d5usjd2, d5usje2, d5usjf2
    automated match to d4obea_
    complexed with gnp, mg; mutant

Details for d5usjb1

PDB Entry: 5usj (more details), 1.94 Å

PDB Description: crystal structure of human kras g12d mutant in complex with gdpnp
PDB Compounds: (B:) GTPase KRas

SCOPe Domain Sequences for d5usjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5usjb1 c.37.1.8 (B:1-167) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgadgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdl
psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhk

SCOPe Domain Coordinates for d5usjb1:

Click to download the PDB-style file with coordinates for d5usjb1.
(The format of our PDB-style files is described here.)

Timeline for d5usjb1:

  • d5usjb1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-23