SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5uwob_ (5uwo B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2061576Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2061577Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2062158Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 2062159Protein automated matches [190052] (6 species)
    not a true protein
  7. 2062160Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [194506] (31 PDB entries)
  8. 2288866Domain d5uwob_: 5uwo B: [332167]
    Other proteins in same PDB: d5uwoa_
    automated match to d4wvfb_
    complexed with gnp, gol, mg

Details for d5uwob_

PDB Entry: 5uwo (more details), 2.35 Å

PDB Description: crystal structure of engineered fmrp-1b nes peptide in complex with crm1-ran-ranbp1
PDB Compounds: (B:) Ran-specific GTPase-activating protein 1

SCOPe Domain Sequences for d5uwob_:

Sequence, based on SEQRES records: (download)

>d5uwob_ b.55.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ihfepvvhlekvdvktmeedeevlykvraklfrfdadakewkergtgdckflknkktnkv
rilmrrdktlkicanhiiapeytlkpnvgsdrswvyactadiaegeaeaftfairfgske
nadkfkeefekaqeink

Sequence, based on observed residues (ATOM records): (download)

>d5uwob_ b.55.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ihfepvtmeedeevlykvraklfrfdadakewkergtgdckflknkktnkvrilmrrdkt
lkicanhiiapeytlkpnvgsdrswvyactadiaegeaeaftfairfgskenadkfkeef
ekaqeink

SCOPe Domain Coordinates for d5uwob_:

Click to download the PDB-style file with coordinates for d5uwob_.
(The format of our PDB-style files is described here.)

Timeline for d5uwob_:

  • d5uwob_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23