SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5u3ya_ (5u3y A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009403Protein automated matches [190059] (14 species)
    not a true protein
  7. 2009425Species Human (Homo sapiens) [TaxId:9606] [187214] (172 PDB entries)
  8. 2288864Domain d5u3ya_: 5u3y A: [332165]
    automated match to d2p4ya_
    complexed with 7u7, b7g, peg, pgo

Details for d5u3ya_

PDB Entry: 5u3y (more details), 1.9 Å

PDB Description: human ppardelta ligand-binding domain in complexed with specific agonist 9
PDB Compounds: (A:) Peroxisome proliferator-activated receptor delta

SCOPe Domain Sequences for d5u3ya_:

Sequence, based on SEQRES records: (download)

>d5u3ya_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvadlkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwkq
lvnglppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheai
famlasivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlal
fiaaiilcgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlv
tehaqmmqrikktetetslhpllqeiykd

Sequence, based on observed residues (ATOM records): (download)

>d5u3ya_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvadlkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwlp
pykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifamlas
ivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaaii
lcgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlvtehaqm
mqrikktetetslhpllqeiykd

SCOPe Domain Coordinates for d5u3ya_:

Click to download the PDB-style file with coordinates for d5u3ya_.
(The format of our PDB-style files is described here.)

Timeline for d5u3ya_:

  • d5u3ya_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23