Lineage for d1egve_ (1egv E:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 396855Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 396957Superfamily c.51.3: B12-dependent dehydatase associated subunit [52968] (2 families) (S)
  5. 396958Family c.51.3.1: Diol dehydratase, beta subunit [52969] (1 protein)
    contains additional structures in the C-terminal extension
  6. 396959Protein Diol dehydratase, beta subunit [52970] (2 species)
  7. 396960Species Klebsiella oxytoca [TaxId:571] [52971] (7 PDB entries)
  8. 396968Domain d1egve_: 1egv E: [33216]
    Other proteins in same PDB: d1egva_, d1egvg_, d1egvl_, d1egvm_
    complexed with coy, k, pgo

Details for d1egve_

PDB Entry: 1egv (more details), 1.75 Å

PDB Description: crystal structure of the diol dehydratase-adeninylpentylcobalamin complex from klebsella oxytoca under the illuminated condition.

SCOP Domain Sequences for d1egve_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1egve_ c.51.3.1 (E:) Diol dehydratase, beta subunit {Klebsiella oxytoca}
gfltevgearqgtqqdeviiavgpafglaqtvnivgiphksilreviagieeegikarvi
rcfkssdvafvavegnrlsgsgisigiqskgttvihqqglpplsnlelfpqaplltlety
rqigknaaryakrespqpvptlndqmarpkyqaksailhiketkyvvtgknpqelrva

SCOP Domain Coordinates for d1egve_:

Click to download the PDB-style file with coordinates for d1egve_.
(The format of our PDB-style files is described here.)

Timeline for d1egve_: