SCOPe 2.06: Domain d5tz3a1: 5tz3 A:579-916

Lineage for d5tz3a1 (5tz3 A:579-916)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188676] (111 PDB entries)

8. Domain d5tz3a1: 5tz3 A:579-916 [332159]
   Other proteins in same PDB: d5tz3a2, d5tz3b2
   automated match to d4d09a_
   complexed with 7om, mg, zn

Details for d5tz3a1

PDB Entry: 5tz3, 1.72 Å

PDB Description: crystal structure of human phosphodiesterase 2a in complex with [1,2, 4]triazolo[1,5-a]pyrimidin-7-yl}-n-(naphthalene-2-yl)piperidine-3- carboxamide

PDB Compounds: (A:) cGMP-dependent 3',5'-cyclic phosphodiesterase

SCOPe Domain Sequences for d5tz3a1:

Sequence; same for both SEQRES and ATOM records:

>d5tz3a1 a.211.1.0 (A:579-916) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddeytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcpt
larfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchdl
dhrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrml
dlmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwkt
trkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdlf
pkaaelyervasnrehwtkvshkftirglpsnnsldfl

Timeline for d5tz3a1:

• d5tz3a1 is new in SCOPe 2.06-stable
  
• d5tz3a1 appears in SCOPe 2.07
  
• d5tz3a1 appears in the current release, SCOPe 2.08