Lineage for d5jsha_ (5jsh A:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2222239Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 2222240Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 2222241Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (2 protein domains)
  6. 2222271Protein automated matches [190110] (7 species)
    not a true protein
  7. 2222348Species Desulfovibrio vulgaris [TaxId:882] [197352] (11 PDB entries)
  8. 2288849Domain d5jsha_: 5jsh A: [332150]
    automated match to d3ze9a_
    complexed with 6ml, cl, fco, fe2, h2s, ni, sf4

Details for d5jsha_

PDB Entry: 5jsh (more details), 1.3 Å

PDB Description: the 3d structure of recombinant [nifese] hydrogenase from desulfovibrio vulgaris hildenborough in the oxidized state at 1.30 angstrom
PDB Compounds: (A:) periplasmic [nifese] hydrogenase, small subunit

SCOPe Domain Sequences for d5jsha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jsha_ e.19.1.1 (A:) automated matches {Desulfovibrio vulgaris [TaxId: 882]}
gtltgerppvfwlqgqgctgcsvtllnsvhpsiadvllkvislefhptvmawegehaieh
mrkvaekfkgkfflviegsvpveadgkyciigeanhheismvdalkefgpnaaavlavgt
caayggipaaegsetgatavskflgdngiktpvvnipgcpphpdwivgtvvlaldaikkn
glegglaevvkvldsdgrptpffgrnihencpyldkydegvmsatftdkvgcrydlgckg
pmtmadcferkwnggvnwcvqnavcigcvepdfpdgkspfyqa

SCOPe Domain Coordinates for d5jsha_:

Click to download the PDB-style file with coordinates for d5jsha_.
(The format of our PDB-style files is described here.)

Timeline for d5jsha_:

  • d5jsha_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23