SCOP 1.67: Domain d1eexb_: 1eex B:

Lineage for d1eexb_ (1eex B:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.3: B12-dependent dehydatase associated subunit [52968] (2 families)

5. Family c.51.3.1: Diol dehydratase, beta subunit [52969] (1 protein)
   contains additional structures in the C-terminal extension

6. Protein Diol dehydratase, beta subunit [52970] (2 species)

7. Species Klebsiella oxytoca [TaxId:571] [52971] (7 PDB entries)

8. Domain d1eexb_: 1eex B: [33213]
   Other proteins in same PDB: d1eexa_, d1eexg_, d1eexl_, d1eexm_

Details for d1eexb_

PDB Entry: 1eex, 1.7 Å

PDB Description: crystal structure of the diol dehydratase-adeninylpentylcobalamin complex from klebsiella oxytoca

SCOP Domain Sequences for d1eexb_:

Sequence; same for both SEQRES and ATOM records:

>d1eexb_ c.51.3.1 (B:) Diol dehydratase, beta subunit {Klebsiella oxytoca}
gfltevgearqgtqqdeviiavgpafglaqtvnivgiphksilreviagieeegikarvi
rcfkssdvafvavegnrlsgsgisigiqskgttvihqqglpplsnlelfpqaplltlety
rqigknaaryakrespqpvptlndqmarpkyqaksailhiketkyvvtgknpqelrva

Timeline for d1eexb_:

• d1eexb_ first appeared (with stable ids) in SCOP 1.55
  
• d1eexb_ appears in SCOP 1.65
  
• d1eexb_ appears in SCOP 1.69
  
• d1eexb_ appears in the current release, SCOPe 2.08