SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5u95b_ (5u95 B:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2222543Fold e.23: Acetyl-CoA synthetase-like [56800] (1 superfamily)
    4 domains: (1&2) duplication: share the same alpha/beta fold; (3) beta-barrel; (4) alpha+beta
  4. 2222544Superfamily e.23.1: Acetyl-CoA synthetase-like [56801] (2 families) (S)
  5. 2222620Family e.23.1.0: automated matches [191594] (1 protein)
    not a true family
  6. 2222621Protein automated matches [191083] (22 species)
    not a true protein
  7. 2273880Species Nicotiana tabacum [TaxId:4097] [317181] (5 PDB entries)
  8. 2288818Domain d5u95b_: 5u95 B: [332119]
    automated match to d3a9ua_
    complexed with ca

Details for d5u95b_

PDB Entry: 5u95 (more details), 2.25 Å

PDB Description: structure of the open conformation of 4-coumarate-coa ligase from nicotiana tabacum
PDB Compounds: (B:) 4-coumarate--CoA ligase 2

SCOPe Domain Sequences for d5u95b_:

Sequence, based on SEQRES records: (download)

>d5u95b_ e.23.1.0 (B:) automated matches {Nicotiana tabacum [TaxId: 4097]}
diifrsklpdiyipnhlplhsycfenisefssrpclingankqiytyadvelnsrkvaag
lhkqgiqpkdtimillpnspefvfafigasylgaistmanplftpaevvkqakassakii
vtqachvnkvkdyafendvkiicidsapegclhfsvltqanehdipeveiqpddvvalpy
ssgttglpkgvmlthkglvtsvaqqvdgenpnlyihsedvmlcvlplfhiyslnsvllcg
lrvgaailimqkfdivsfleliqsykvtigpfvppivlaiakspmvddydlssvrtvmsg
aaplgkeledtvrakfpnaklgqgygmteagpvlamclafakepfeiksgacgtvvrnae
mkivdpktgnslprnqsgeicirgdqimkgylndpeatartidkegwlytgdigyidddd
elfivdrlkelikykgfqvapaelealllnhpnisdaavvpmkdeqagevpvafvvrsng
stitedevkdfiskqvifykrikrvffvdaipkspsgkilrkdlraklaa

Sequence, based on observed residues (ATOM records): (download)

>d5u95b_ e.23.1.0 (B:) automated matches {Nicotiana tabacum [TaxId: 4097]}
diifrsklpdiyipnhlplhsycfenisefssrpclingankqiytyadvelnsrkvaag
lhkqgiqpkdtimillpnspefvfafigasylgaistmanplftpaevvkqakassakii
vtqachvnkvkdyafendvkiicidsapegclhfsvltqanehdipeveiqpddvvalpy
ssgttglpkgvmlthkglvtsvaqqvdgenpnlyihsedvmlcvlplfhiyslnsvllcg
lrvgaailimqkfdivsfleliqsykvtigpfvppivlaiakspmvddydlssvrtvmsg
aaplgkeledtvrakfpnaklgqgygmteagpvlamclafakepfeiksgacgtvvrnae
mkivdpktgnslprnqsgeicirgdqimkgylndpeatartidkegwlytgdigyidddd
elfivdrlkelikykgfqvapaelealllnhpnisdaavvpmkagevpvafvvrsngsti
tedevkdfiskqvifykrikrvffvdaipkspsgkilrkdlraklaa

SCOPe Domain Coordinates for d5u95b_:

Click to download the PDB-style file with coordinates for d5u95b_.
(The format of our PDB-style files is described here.)

Timeline for d5u95b_:

  • d5u95b_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23