Lineage for d5u95b_ (5u95 B:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2222543Fold e.23: Acetyl-CoA synthetase-like [56800] (1 superfamily)
    4 domains: (1&2) duplication: share the same alpha/beta fold; (3) beta-barrel; (4) alpha+beta
  4. 2222544Superfamily e.23.1: Acetyl-CoA synthetase-like [56801] (2 families) (S)
  5. 2222620Family e.23.1.0: automated matches [191594] (1 protein)
    not a true family
  6. 2222621Protein automated matches [191083] (22 species)
    not a true protein
  7. 2273880Species Nicotiana tabacum [TaxId:4097] [317181] (5 PDB entries)
  8. 2288818Domain d5u95b_: 5u95 B: [332119]
    automated match to d3a9ua_
    complexed with ca

Details for d5u95b_

PDB Entry: 5u95 (more details), 2.25 Å

PDB Description: structure of the open conformation of 4-coumarate-coa ligase from nicotiana tabacum
PDB Compounds: (B:) 4-coumarate--CoA ligase 2

SCOPe Domain Sequences for d5u95b_:

Sequence, based on SEQRES records: (download)

>d5u95b_ e.23.1.0 (B:) automated matches {Nicotiana tabacum [TaxId: 4097]}
diifrsklpdiyipnhlplhsycfenisefssrpclingankqiytyadvelnsrkvaag
lhkqgiqpkdtimillpnspefvfafigasylgaistmanplftpaevvkqakassakii
vtqachvnkvkdyafendvkiicidsapegclhfsvltqanehdipeveiqpddvvalpy
ssgttglpkgvmlthkglvtsvaqqvdgenpnlyihsedvmlcvlplfhiyslnsvllcg
lrvgaailimqkfdivsfleliqsykvtigpfvppivlaiakspmvddydlssvrtvmsg
aaplgkeledtvrakfpnaklgqgygmteagpvlamclafakepfeiksgacgtvvrnae
mkivdpktgnslprnqsgeicirgdqimkgylndpeatartidkegwlytgdigyidddd
elfivdrlkelikykgfqvapaelealllnhpnisdaavvpmkdeqagevpvafvvrsng
stitedevkdfiskqvifykrikrvffvdaipkspsgkilrkdlraklaa

Sequence, based on observed residues (ATOM records): (download)

>d5u95b_ e.23.1.0 (B:) automated matches {Nicotiana tabacum [TaxId: 4097]}
diifrsklpdiyipnhlplhsycfenisefssrpclingankqiytyadvelnsrkvaag
lhkqgiqpkdtimillpnspefvfafigasylgaistmanplftpaevvkqakassakii
vtqachvnkvkdyafendvkiicidsapegclhfsvltqanehdipeveiqpddvvalpy
ssgttglpkgvmlthkglvtsvaqqvdgenpnlyihsedvmlcvlplfhiyslnsvllcg
lrvgaailimqkfdivsfleliqsykvtigpfvppivlaiakspmvddydlssvrtvmsg
aaplgkeledtvrakfpnaklgqgygmteagpvlamclafakepfeiksgacgtvvrnae
mkivdpktgnslprnqsgeicirgdqimkgylndpeatartidkegwlytgdigyidddd
elfivdrlkelikykgfqvapaelealllnhpnisdaavvpmkagevpvafvvrsngsti
tedevkdfiskqvifykrikrvffvdaipkspsgkilrkdlraklaa

SCOPe Domain Coordinates for d5u95b_:

Click to download the PDB-style file with coordinates for d5u95b_.
(The format of our PDB-style files is described here.)

Timeline for d5u95b_:

  • d5u95b_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23