SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tdsf_ (5tds F:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2158219Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2160960Superfamily d.15.12: TmoB-like [110814] (2 families) (S)
    possibly related to the ubiquitin-like and/or 2Fe-2S ferredoxin-like superfamilies
  5. 2160982Family d.15.12.0: automated matches [191572] (1 protein)
    not a true family
  6. 2160983Protein automated matches [190991] (1 species)
    not a true protein
  7. 2160984Species Pseudomonas mendocina [TaxId:300] [188696] (20 PDB entries)
  8. 2288814Domain d5tdsf_: 5tds F: [332115]
    Other proteins in same PDB: d5tdsa_, d5tdsd_
    automated match to d3q14c_
    complexed with cl, fe, mbn, mg

Details for d5tdsf_

PDB Entry: 5tds (more details), 1.72 Å

PDB Description: toluene bound in the resting active site of toluene 4-monooxygenase (t4moh)
PDB Compounds: (F:) Toluene-4-monooxygenase system protein B

SCOPe Domain Sequences for d5tdsf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tdsf_ d.15.12.0 (F:) automated matches {Pseudomonas mendocina [TaxId: 300]}
safpvhaafekdflvqlvvvdlndsmdqvaekvayhcvnrrvapregvmrvrkhrstelf
prdmtiaesglnptevidvvfee

SCOPe Domain Coordinates for d5tdsf_:

Click to download the PDB-style file with coordinates for d5tdsf_.
(The format of our PDB-style files is described here.)

Timeline for d5tdsf_:

  • d5tdsf_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23