SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tdvg_ (5tdv G:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2158219Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2160960Superfamily d.15.12: TmoB-like [110814] (2 families) (S)
    possibly related to the ubiquitin-like and/or 2Fe-2S ferredoxin-like superfamilies
  5. 2160982Family d.15.12.0: automated matches [191572] (1 protein)
    not a true family
  6. 2160983Protein automated matches [190991] (1 species)
    not a true protein
  7. 2160984Species Pseudomonas mendocina [TaxId:300] [188696] (20 PDB entries)
  8. 2288813Domain d5tdvg_: 5tdv G: [332114]
    Other proteins in same PDB: d5tdva_, d5tdvd_, d5tdve_, d5tdvh_
    automated match to d3q14c_
    complexed with fe, per

Details for d5tdvg_

PDB Entry: 5tdv (more details), 2 Å

PDB Description: intermediate o2 diiron complex in the q228a variant of toluene 4- moonoxygenase (t4mohd)
PDB Compounds: (G:) Toluene-4-monooxygenase system protein B

SCOPe Domain Sequences for d5tdvg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tdvg_ d.15.12.0 (G:) automated matches {Pseudomonas mendocina [TaxId: 300]}
safpvhaafekdflvqlvvvdlndsmdqvaekvayhcvnrrvapregvmrvrkhrstelf
prdmtiaesglnptevidvvfe

SCOPe Domain Coordinates for d5tdvg_:

Click to download the PDB-style file with coordinates for d5tdvg_.
(The format of our PDB-style files is described here.)

Timeline for d5tdvg_:

  • d5tdvg_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23