SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tdtg_ (5tdt G:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2158219Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2160960Superfamily d.15.12: TmoB-like [110814] (2 families) (S)
    possibly related to the ubiquitin-like and/or 2Fe-2S ferredoxin-like superfamilies
  5. 2160982Family d.15.12.0: automated matches [191572] (1 protein)
    not a true family
  6. 2160983Protein automated matches [190991] (1 species)
    not a true protein
  7. 2160984Species Pseudomonas mendocina [TaxId:300] [188696] (20 PDB entries)
  8. 2288812Domain d5tdtg_: 5tdt G: [332113]
    Other proteins in same PDB: d5tdta_, d5tdtd_, d5tdte_, d5tdth_
    automated match to d3q14c_
    complexed with fe, mbn, per

Details for d5tdtg_

PDB Entry: 5tdt (more details), 1.82 Å

PDB Description: oxygenated toluene intermediate in toluene 4-monooxygenase (t4mohd) after reaction in the crystal
PDB Compounds: (G:) Toluene-4-monooxygenase system protein B

SCOPe Domain Sequences for d5tdtg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tdtg_ d.15.12.0 (G:) automated matches {Pseudomonas mendocina [TaxId: 300]}
safpvhaafekdflvqlvvvdlndsmdqvaekvayhcvnrrvapregvmrvrkhrstelf
prdmtiaesglnptevidvvfe

SCOPe Domain Coordinates for d5tdtg_:

Click to download the PDB-style file with coordinates for d5tdtg_.
(The format of our PDB-style files is described here.)

Timeline for d5tdtg_:

  • d5tdtg_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23