SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5t7ha_ (5t7h A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1980368Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1980369Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1980370Family a.3.1.1: monodomain cytochrome c [46627] (16 protein domains)
  6. 1980579Protein Mitochondrial cytochrome c [46642] (7 species)
  7. 1980580Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (70 PDB entries)
    Uniprot P00044
  8. 2288807Domain d5t7ha_: 5t7h A: [332108]
    automated match to d2bcnb_
    complexed with hem, so4, ze7

Details for d5t7ha_

PDB Entry: 5t7h (more details), 2 Å

PDB Description: crystal structure of dimeric yeast iso-1-cytochrome c with cymal6
PDB Compounds: (A:) Cytochrome c iso-1

SCOPe Domain Sequences for d5t7ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t7ha_ a.3.1.1 (A:) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
fkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikknv
lwdennmseyltnpakyipgtkmafgglkkekdrndlitylkkase

SCOPe Domain Coordinates for d5t7ha_:

Click to download the PDB-style file with coordinates for d5t7ha_.
(The format of our PDB-style files is described here.)

Timeline for d5t7ha_:

  • d5t7ha_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23