Lineage for d5tdve_ (5tdv E:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2216843Fold d.137: Monooxygenase (hydroxylase) regulatory protein [56028] (1 superfamily)
    corner-like structure formed by two sheets and filled in with 2-3 helices
  4. 2216844Superfamily d.137.1: Monooxygenase (hydroxylase) regulatory protein [56029] (1 family) (S)
    duplication: consists of two beta-alpha-(beta)-beta(2) motifs; some topological similarity to the ferredoxin-like fold
  5. 2216845Family d.137.1.1: Monooxygenase (hydroxylase) regulatory protein [56030] (4 proteins)
    note: the solution structure determinations disagree in the relative orientations of two motifs
  6. 2216859Protein Toluene-4-monooxygenase catalytic effector protein [64394] (1 species)
  7. 2216860Species Pseudomonas mendocina [TaxId:300] [64395] (18 PDB entries)
  8. 2216880Domain d5tdve_: 5tdv E: [332107]
    Other proteins in same PDB: d5tdva_, d5tdvc_, d5tdvd_, d5tdvg_
    automated match to d3dhie_
    complexed with fe, per

Details for d5tdve_

PDB Entry: 5tdv (more details), 2 Å

PDB Description: intermediate o2 diiron complex in the q228a variant of toluene 4- moonoxygenase (t4mohd)
PDB Compounds: (E:) toluene-4-monooxygenase system protein d

SCOPe Domain Sequences for d5tdve_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tdve_ d.137.1.1 (E:) Toluene-4-monooxygenase catalytic effector protein {Pseudomonas mendocina [TaxId: 300]}
tlaqqalhnnnvgpiiragdlvepvietaeidnpgkeitvedrrayvriaaegeliltrk
tleeqlgrpfnmqeleinlasfagqiqadedqirfyfdktm

SCOPe Domain Coordinates for d5tdve_:

Click to download the PDB-style file with coordinates for d5tdve_.
(The format of our PDB-style files is described here.)

Timeline for d5tdve_: