Lineage for d5trxa2 (5trx A:148-361)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2166686Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2166687Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2166848Family d.32.1.3: Extradiol dioxygenases [54602] (5 protein domains)
    duplication: consists of 2 similar domains with 2 repeats in each
    Similar to the Methylmalonyl-CoA epimerase dimer
  6. 2166939Protein Homoprotocatechuate 2,3-dioxygenase [89886] (2 species)
  7. 2166953Species Brevibacterium fuscum [TaxId:47914] [89888] (17 PDB entries)
  8. 2288799Domain d5trxa2: 5trx A:148-361 [332100]
    automated match to d1q0oa2
    complexed with ca, cl, fe2

Details for d5trxa2

PDB Entry: 5trx (more details), 2.38 Å

PDB Description: room temperature structure of an extradiol ring-cleaving dioxygenase from b.fuscum determined using serial femtosecond crystallography
PDB Compounds: (A:) homoprotocatechuate 2,3-dioxygenase

SCOPe Domain Sequences for d5trxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5trxa2 d.32.1.3 (A:148-361) Homoprotocatechuate 2,3-dioxygenase {Brevibacterium fuscum [TaxId: 47914]}
gelvrldhfnqvtpdvprgrkyledlgfrvtediqddegttyaawmhrkgtvhdtaltgg
ngprlhhvafsthekhniiqicdkmgalrisdriergpgrhgvsnafylyildpdnhrie
iytqdyytgdpdnptitwnvhdnqrrdwwgnpvvpswyteaskvldldgnvqeiiertdd
selevtigadgfsftragdedgsyhgqaskgfkl

SCOPe Domain Coordinates for d5trxa2:

Click to download the PDB-style file with coordinates for d5trxa2.
(The format of our PDB-style files is described here.)

Timeline for d5trxa2:

  • d5trxa2 appears in periodic updates to SCOPe 2.06 starting on 2017-03-23