Lineage for d5tdsd_ (5tds D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988413Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1988414Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1990025Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 protein domains)
  6. 1990319Protein automated matches [190435] (11 species)
    not a true protein
  7. 1990411Species Pseudomonas mendocina [TaxId:300] [188695] (20 PDB entries)
  8. 2288793Domain d5tdsd_: 5tds D: [332094]
    Other proteins in same PDB: d5tdsc_, d5tdsf_
    automated match to d3dhgd_
    complexed with cl, fe, mbn, mg

Details for d5tdsd_

PDB Entry: 5tds (more details), 1.72 Å

PDB Description: toluene bound in the resting active site of toluene 4-monooxygenase (t4moh)
PDB Compounds: (D:) Toluene-4-monooxygenase system protein A

SCOPe Domain Sequences for d5tdsd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tdsd_ a.25.1.2 (D:) automated matches {Pseudomonas mendocina [TaxId: 300]}
amhprkdwyeltratnwtpsyvteeqlfpermsghmgiplekwesydepyktsypeyvsi
qrekdagaysvkaalerakiyensdpgwistlkshygaiavgeyaavtgegrmarfskap
gnrnmatfgmmdelrhgqlqlffpheyckkdrqfdwawrayhsnewaaiaakhffddiit
grdaisvaimltfsfetgftnmqflglaadaaeagdytfanlissiqtdesrhaqqggpa
lqlliengkreeaqkkvdmaiwrawrlfavltgpvmdyytpledrsqsfkefmyewiigq
ferslidlgldkpwywdlflkdidelhhsyhmgvwywrttawwnpaagvtpeerdwleek
ypgwnkrwgrcwdvitenvlndrmdlvspetlpsvcnmsqiplvgvpgddwnievfsleh
ngrlyhfgsevdrwvfqqdpvqyqnhmnivdrflagqiqpmtlegalkymgfqsieemgk
dahdfawadk

SCOPe Domain Coordinates for d5tdsd_:

Click to download the PDB-style file with coordinates for d5tdsd_.
(The format of our PDB-style files is described here.)

Timeline for d5tdsd_:

  • d5tdsd_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23