SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tdue_ (5tdu E:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2194444Fold d.137: Monooxygenase (hydroxylase) regulatory protein [56028] (1 superfamily)
    corner-like structure formed by two sheets and filled in with 2-3 helices
  4. 2194445Superfamily d.137.1: Monooxygenase (hydroxylase) regulatory protein [56029] (1 family) (S)
    duplication: consists of two beta-alpha-(beta)-beta(2) motifs; some topological similarity to the ferredoxin-like fold
  5. 2194446Family d.137.1.1: Monooxygenase (hydroxylase) regulatory protein [56030] (4 protein domains)
    note: the solution structure determinations disagree in the relative orientations of two motifs
  6. 2194460Protein Toluene-4-monooxygenase catalytic effector protein [64394] (1 species)
  7. 2194461Species Pseudomonas mendocina [TaxId:300] [64395] (18 PDB entries)
  8. 2288782Domain d5tdue_: 5tdu E: [332083]
    Other proteins in same PDB: d5tdua_, d5tduc_
    automated match to d3dhie_
    complexed with fe, pcr

Details for d5tdue_

PDB Entry: 5tdu (more details), 1.74 Å

PDB Description: toluene 4-monooxygenase (t4mohd) bound to product after turnover in crystal
PDB Compounds: (E:) toluene-4-monooxygenase system protein d

SCOPe Domain Sequences for d5tdue_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tdue_ d.137.1.1 (E:) Toluene-4-monooxygenase catalytic effector protein {Pseudomonas mendocina [TaxId: 300]}
stladqalhnnnvgpiiragdlvepvietaeidnpgkeitvedrrayvriaaegeliltr
ktleeqlgrpfnmqeleinlasfagqiqadedqirfyfdktm

SCOPe Domain Coordinates for d5tdue_:

Click to download the PDB-style file with coordinates for d5tdue_.
(The format of our PDB-style files is described here.)

Timeline for d5tdue_:

  • d5tdue_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23