Class a: All alpha proteins [46456] (289 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.2: Bromodomain [47370] (2 families) |
Family a.29.2.0: automated matches [191428] (1 protein) not a true family |
Protein automated matches [190615] (10 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187641] (647 PDB entries) |
Domain d5pdsa1: 5pds A:1858-1970 [331934] Other proteins in same PDB: d5pdsa2 automated match to d3uv2a_ complexed with edo |
PDB Entry: 5pds (more details), 1.78 Å
SCOPe Domain Sequences for d5pdsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5pdsa1 a.29.2.0 (A:1858-1970) automated matches {Human (Homo sapiens) [TaxId: 9606]} svkkpkrddskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstirek lssgqypnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtfk
Timeline for d5pdsa1: