SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5pfoa1 (5pfo A:1858-1970)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1992366Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1992367Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1992467Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 1992468Protein automated matches [190615] (8 species)
    not a true protein
  7. 1992472Species Human (Homo sapiens) [TaxId:9606] [187641] (589 PDB entries)
  8. 2288585Domain d5pfoa1: 5pfo A:1858-1970 [331886]
    Other proteins in same PDB: d5pfoa2
    automated match to d3uv2a_
    complexed with edo

Details for d5pfoa1

PDB Entry: 5pfo (more details), 1.82 Å

PDB Description: pandda analysis group deposition -- crystal structure of baz2b after initial refinement with no ligand modelled (structure 152)
PDB Compounds: (A:) Bromodomain adjacent to zinc finger domain protein 2B

SCOPe Domain Sequences for d5pfoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5pfoa1 a.29.2.0 (A:1858-1970) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svkkpkrddskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstirek
lssgqypnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtfk

SCOPe Domain Coordinates for d5pfoa1:

Click to download the PDB-style file with coordinates for d5pfoa1.
(The format of our PDB-style files is described here.)

Timeline for d5pfoa1:

  • d5pfoa1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-23

View in 3D
Domains from same chain:
(mouse over for more information)
d5pfoa2