SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5mw3b_ (5mw3 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130146Family c.66.1.31: Catalytic, N-terminal domain of histone methyltransferase Dot1l [89746] (2 protein domains)
  6. 2130154Protein automated matches [191247] (1 species)
    not a true protein
  7. 2130155Species Human (Homo sapiens) [TaxId:9606] [189737] (27 PDB entries)
  8. 2288516Domain d5mw3b_: 5mw3 B: [331817]
    automated match to d4hraa_
    complexed with 5jj, 5jt, tla

Details for d5mw3b_

PDB Entry: 5mw3 (more details), 2.09 Å

PDB Description: crystal structure of dot1l in complex with inhibitor cpd1 [n6-(2,6- dichlorophenyl)-n6-(pent-2-yn-1-yl)quinoline-4,6-diamine] and inhibitor cpd2 [(r)-1-(7h-pyrrolo[2,3-d]pyrimidin-4-yl)piperidin-3- amine]
PDB Compounds: (B:) Histone-lysine N-methyltransferase, H3 lysine-79 specific

SCOPe Domain Sequences for d5mw3b_:

Sequence, based on SEQRES records: (download)

>d5mw3b_ c.66.1.31 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
klelrlkspvgaepavypwplpvydkhhdaaheiietirwvceeipdlklamenyvlidy
dtksfesmqrlcdkynraidsihqlwkgttqpmklntrpstgllrhilqqvynhsvtdpe
klnnyepfspevygetsfdlvaqmideikmtdddlfvdlgsgvgqvvlqvaaatnckhhy
gvekadipakyaetmdrefrkwmkwygkkhaeytlergdflseewreriantsvifvnnf
afgpevdhqlkerfanmkeggrivsskpfaplnfrinsrnlsdigtimrvvelsplkgsv
swtgkpvsyylhtidrtilenyfsslkn

Sequence, based on observed residues (ATOM records): (download)

>d5mw3b_ c.66.1.31 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
klelrlkspvgaepavypwplpvydkhhdaaheiietirwvceeipdlklamenyvlidy
dtksfesmqrlcdkynraidsihqlwkgtlntrpstgllrhilqqvynhsvtdpeklnny
epfspevygetsfdlvaqmideikmtdddlfvdlgsgvgqvvlqvaaatnckhhygveka
dipakyaetmdrefrkwmkwygkkhaeytlergdflseewreriantsvifvnnfafgpe
vdhqlkerfanmkeggrivsskpfaplnfrinsrnlsdigtimrvvelsplkvswtgkpv
syylhtidrtilenyfsslkn

SCOPe Domain Coordinates for d5mw3b_:

Click to download the PDB-style file with coordinates for d5mw3b_.
(The format of our PDB-style files is described here.)

Timeline for d5mw3b_:

  • d5mw3b_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23