SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5lxgh_ (5lxg H:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2019634Protein automated matches [190119] (21 species)
    not a true protein
  7. 2020203Species Mouse (Mus musculus) [TaxId:10090] [186842] (149 PDB entries)
  8. 2288458Domain d5lxgh_: 5lxg H: [331759]
    automated match to d3wxwh_
    complexed with so4, zn

Details for d5lxgh_

PDB Entry: 5lxg (more details), 2.73 Å

PDB Description: revised crystal structure of the human adiponectin receptor 1 in an open conformation
PDB Compounds: (H:) V region heavy chain

SCOPe Domain Sequences for d5lxgh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lxgh_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evllqqsgpelvkpgasvritckasgytftdfnmdwvkqspgkslewigdfnpnsggsiy
nqkfkdkatftvdkssstaymelrsltfedtavyycaretgtawfaywgqgtlvtvsaa

SCOPe Domain Coordinates for d5lxgh_:

Click to download the PDB-style file with coordinates for d5lxgh_.
(The format of our PDB-style files is described here.)

Timeline for d5lxgh_:

  • d5lxgh_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23