Lineage for d5lxgh_ (5lxg H:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2019634Protein automated matches [190119] (22 species)
    not a true protein
  7. 2020203Species Mouse (Mus musculus) [TaxId:10090] [186842] (156 PDB entries)
  8. 2288458Domain d5lxgh_: 5lxg H: [331759]
    automated match to d3wxwh_
    complexed with so4, zn

Details for d5lxgh_

PDB Entry: 5lxg (more details), 2.73 Å

PDB Description: revised crystal structure of the human adiponectin receptor 1 in an open conformation
PDB Compounds: (H:) V region heavy chain

SCOPe Domain Sequences for d5lxgh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lxgh_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evllqqsgpelvkpgasvritckasgytftdfnmdwvkqspgkslewigdfnpnsggsiy
nqkfkdkatftvdkssstaymelrsltfedtavyycaretgtawfaywgqgtlvtvsaa

SCOPe Domain Coordinates for d5lxgh_:

Click to download the PDB-style file with coordinates for d5lxgh_.
(The format of our PDB-style files is described here.)

Timeline for d5lxgh_:

  • d5lxgh_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23