SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5lh9d_ (5lh9 D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (118 species)
    not a true protein
  7. 2272179Species Pseudomonas sp. [TaxId:306] [315480] (5 PDB entries)
  8. 2288457Domain d5lh9d_: 5lh9 D: [331758]
    automated match to d3drda_
    complexed with plp

Details for d5lh9d_

PDB Entry: 5lh9 (more details), 1.95 Å

PDB Description: amine transaminase crystal structure from an uncultivated pseudomonas species in the plp-bound (internal aldimine) form
PDB Compounds: (D:) omega transaminase

SCOPe Domain Sequences for d5lh9d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lh9d_ c.67.1.0 (D:) automated matches {Pseudomonas sp. [TaxId: 306]}
syekyknaekkfwhpmgssaaphrdktlviargdgnyitdidgqrmldgvgglwnvnigh
nrasvkaaiaaqldelayyqtfdgiahprvfdlaerltgmfaqermarvlfssggsdave
talkmarqywiasgepgrtrflslrngyhgvhmggtsvggngvyhynhgqllagchlldt
pwlyrnpwdcrdpqaltahcirqleeqiallgaqtiaaliaepvqgaggvivppadywpr
lrevcdrhgilliadevvtgfgrsgcmlgsrgwgvapdilclakgitagyiplgatlfnq
riadaiengqgfshmimhgytysghptacaaalavldiveaedlpgnaakvgaqlleqlq
plveryavvgevrgkglmialdlvsdkrtrqpldpaagqpsriadearragvlvrpignk
iilsppltltrdeaglmvsaleaafarcg

SCOPe Domain Coordinates for d5lh9d_:

Click to download the PDB-style file with coordinates for d5lh9d_.
(The format of our PDB-style files is described here.)

Timeline for d5lh9d_:

  • d5lh9d_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23