Lineage for d5ixgc_ (5ixg C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2805786Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2806605Superfamily b.61.6: YceI-like [101874] (2 families) (S)
  5. 2806617Family b.61.6.0: automated matches [191627] (1 protein)
    not a true family
  6. 2806618Protein automated matches [191150] (3 species)
    not a true protein
  7. 2806619Species Burkholderia cenocepacia [TaxId:350702] [331662] (1 PDB entry)
  8. 2806622Domain d5ixgc_: 5ixg C: [331739]
    automated match to d1y0ga_
    complexed with otp, peg

Details for d5ixgc_

PDB Entry: 5ixg (more details), 1.6 Å

PDB Description: crystal structure of burkholderia cenocepacia bcnb
PDB Compounds: (C:) YceI

SCOPe Domain Sequences for d5ixgc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ixgc_ b.61.6.0 (C:) automated matches {Burkholderia cenocepacia [TaxId: 350702]}
satyqfdpshtypsfeadhfgglsvwrgkfdkssgtvtldraaktgtvdvttdiasihtg
sakldehlqtaeffdaakfpqanykgtikfdgdkpvsvvgnltlhgvtkpltlkidsfkc
mphpmlkrevcgvdavgefsrddfgldygkqygfkmktkllitaeavkq

SCOPe Domain Coordinates for d5ixgc_:

Click to download the PDB-style file with coordinates for d5ixgc_.
(The format of our PDB-style files is described here.)

Timeline for d5ixgc_: