Lineage for d5mzab2 (5mza B:83-185)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026100Family b.1.1.3: C2 set domains [49142] (8 protein domains)
  6. 2026164Protein Intercellular cell adhesion molecule-1 (ICAM-1) [49145] (1 species)
  7. 2026165Species Human (Homo sapiens) [TaxId:9606] [49146] (7 PDB entries)
  8. 2288436Domain d5mzab2: 5mza B:83-185 [331737]
    Other proteins in same PDB: d5mzab1, d5mzab3
    automated match to d1z7zi1
    complexed with 3po, ihp, nag

Details for d5mzab2

PDB Entry: 5mza (more details), 2.78 Å

PDB Description: the dblb domain of pf11_0521 pfemp1 bound to human icam-1
PDB Compounds: (B:) Intercellular adhesion molecule 1

SCOPe Domain Sequences for d5mzab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mzab2 b.1.1.3 (B:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]}
ywtpervelaplpswqpvgknltlrcqveggapranltvvllrgekelkrepavgepaev
tttvlvrrdhhganfscrteldlrpqglelfentsapyqlqtf

SCOPe Domain Coordinates for d5mzab2:

Click to download the PDB-style file with coordinates for d5mzab2.
(The format of our PDB-style files is described here.)

Timeline for d5mzab2:

  • d5mzab2 appears in periodic updates to SCOPe 2.06 starting on 2017-03-23