SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5mzab2 (5mza B:83-185)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026100Family b.1.1.3: C2 set domains [49142] (8 protein domains)
  6. 2026164Protein Intercellular cell adhesion molecule-1 (ICAM-1) [49145] (1 species)
  7. 2026165Species Human (Homo sapiens) [TaxId:9606] [49146] (7 PDB entries)
  8. 2288436Domain d5mzab2: 5mza B:83-185 [331737]
    Other proteins in same PDB: d5mzab1, d5mzab3
    automated match to d1z7zi1
    complexed with 3po, ihp, nag

Details for d5mzab2

PDB Entry: 5mza (more details), 2.78 Å

PDB Description: the dblb domain of pf11_0521 pfemp1 bound to human icam-1
PDB Compounds: (B:) Intercellular adhesion molecule 1

SCOPe Domain Sequences for d5mzab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mzab2 b.1.1.3 (B:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]}
ywtpervelaplpswqpvgknltlrcqveggapranltvvllrgekelkrepavgepaev
tttvlvrrdhhganfscrteldlrpqglelfentsapyqlqtf

SCOPe Domain Coordinates for d5mzab2:

Click to download the PDB-style file with coordinates for d5mzab2.
(The format of our PDB-style files is described here.)

Timeline for d5mzab2:

  • d5mzab2 appears in periodic updates to SCOPe 2.06 starting on 2017-03-23