SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5mzab1 (5mza B:1-82)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (27 species)
    not a true protein
  7. 2026747Species Human (Homo sapiens) [TaxId:9606] [187920] (847 PDB entries)
  8. 2288435Domain d5mzab1: 5mza B:1-82 [331736]
    Other proteins in same PDB: d5mzab2, d5mzab3
    automated match to d1z7zi3
    complexed with 3po, ihp, nag

Details for d5mzab1

PDB Entry: 5mza (more details), 2.78 Å

PDB Description: the dblb domain of pf11_0521 pfemp1 bound to human icam-1
PDB Compounds: (B:) Intercellular adhesion molecule 1

SCOPe Domain Sequences for d5mzab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mzab1 b.1.1.0 (B:1-82) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qtsvspskvilprggsvlvtcstscdqpkllgietplpkkelllpgnnrkvyelsnvqed
sqpmcysncpdgqstaktfltv

SCOPe Domain Coordinates for d5mzab1:

Click to download the PDB-style file with coordinates for d5mzab1.
(The format of our PDB-style files is described here.)

Timeline for d5mzab1:

  • d5mzab1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-23